PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc001052.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 346aa    MW: 37926.4 Da    PI: 8.0339
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc001052.1_g00006.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1744.4e-54161431128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+evd+yk++Pw+Lp+k+k +e+ewyfFs+rd+ky++g+r+nra++sgyWkat
  Itr_sc001052.1_g00006.1  16 LPPGFRFHPTDEELVVHYLKKKTASLPLPV-TIIAEVDLYKFDPWELPSKAKFGEQEWYFFSPRDRKYPNGTRPNRAATSGYWKAT 100
                              79****************************.89***************99999********************************* PP

                      NAM  87 gkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g+dk++l+  ++++ g+kk Lvfy+g+ pkg kt+Wvmheyrl
  Itr_sc001052.1_g00006.1 101 GTDKPILTCnGTQKAGVKKALVFYRGKPPKGMKTNWVMHEYRL 143
                              ******98757788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-6412184IPR003441NAC domain
PROSITE profilePS5100561.29516184IPR003441NAC domain
PfamPF023657.7E-2817143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MESTADSRSD SGHPRLPPGF RFHPTDEELV VHYLKKKTAS LPLPVTIIAE VDLYKFDPWE  60
LPSKAKFGEQ EWYFFSPRDR KYPNGTRPNR AATSGYWKAT GTDKPILTCN GTQKAGVKKA  120
LVFYRGKPPK GMKTNWVMHE YRLPDNVVNS MAPSSAHRPL GDDIVNKKSS LRLDDWVLCR  180
IFKKNGSSRP VESGGRGDPT EDATVATSTS LDGCGGAGDH QNPNSRASRG LSFGEFFEIN  240
SGHNLYTGTM MSGGGINGTQ TSWDSPRDQT CMAMGITAAP PRIDEDHHHE TAANNAMMEG  300
STSFISLLNQ LSPNDSASLS NVQTGLGVSI AEGVLHQPYQ LSWLKH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B5e-711618917170NAC domain-containing protein 19
4dul_A5e-711618917170NAC domain-containing protein 19
1ut7_B5e-711618917170NO APICAL MERISTEM PROTEIN
1ut7_A5e-711618917170NO APICAL MERISTEM PROTEIN
1ut4_B5e-711618917170NO APICAL MERISTEM PROTEIN
1ut4_A5e-711618917170NO APICAL MERISTEM PROTEIN
3swp_D5e-711618920173NAC domain-containing protein 19
3swp_C5e-711618920173NAC domain-containing protein 19
3swp_B5e-711618920173NAC domain-containing protein 19
3swp_A5e-711618920173NAC domain-containing protein 19
3swm_D5e-711618920173NAC domain-containing protein 19
3swm_C5e-711618920173NAC domain-containing protein 19
3swm_B5e-711618920173NAC domain-containing protein 19
3swm_A5e-711618920173NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003635288.11e-118PREDICTED: NAC transcription factor 25
SwissprotQ8GY425e-99NAC25_ARATH; NAC transcription factor 25
TrEMBLD7U6G01e-116D7U6G0_VITVI; Putative uncharacterized protein
STRINGVIT_00s0375g00040.t011e-116(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18142466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-100NAC domain containing protein 25